| Name | O_BomoSK11808_complete:A_BomoSK_comp12740_c0_seq1 |
| Scaffold_id | Bomo_Chr12 |
NCBI non-redundant
(nr) | PREDICTED:_bifunctional_ATP-dependent_dihydroxyacetone_kinase/FAD-AMP_lyase_(cyclizing)-like,_partial_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0003824 |
F |
catalytic activity |
| GO:0004371 |
F |
glycerone kinase activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005634 |
C |
nucleus |
| GO:0006071 |
P |
glycerol metabolic process |
| GO:0008152 |
P |
metabolic process |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0016829 |
F |
lyase activity |
| GO:0034012 |
F |
FAD-AMP lyase (cyclizing) activity |
| GO:0039534 |
P |
negative regulation of MDA-5 signaling pathway |
| GO:0044262 |
P |
cellular carbohydrate metabolic process |
| GO:0045088 |
P |
regulation of innate immune response |
| GO:0046835 |
P |
carbohydrate phosphorylation |
| GO:0046872 |
F |
metal ion binding |
| GO:0050354 |
F |
triokinase activity |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_BomoSK_comp12740_c0_seq1 |
Sequence
(Amino Acid) | MGGTSGGIYSLGLSAASQAFSIATSNSVPTWLSALESAIQAISKYGGAEPGDRTMLDTLH
AVAETLKKCIEEELLAVLKKAAEAADHGAKATASMVARAGRASYVASGYTQQEDAGARAA
ALWLQAILCSIASKI
*(44 a.a.) |
