SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK110_internal:A_BomoSK_comp400_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		PREDICTED:_homeobox_protein_B-H1-like_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0003677 F DNA binding
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005634 C nucleus
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007455 P eye-antennal disc morphogenesis
GO:0007479 P leg disc proximal/distal pattern formation
GO:0007601 P visual perception
GO:0008052 P sensory organ boundary specification
GO:0008057 P eye pigment granule organization
GO:0008407 P chaeta morphogenesis
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0050896 P response to stimulus
RNA-seq EntryA_BomoSK_comp400_c0_seq1
Sequence
(Amino Acid)
GGAVAMTVQRDERAPRTRFMITDILDAPPRDLSAHRDSDSDRSATDSPGVKDDSDDVSSK
SCGGDGSGLAKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELAAKLGLTDTQVKTW
YQNRRTKWKRQTAVGLELLAEAGNYAAFQRLYGGYWAGVPAYPTQPAPATADLYYRQAAA
TAAAA
(60 a.a.)

- SilkBase 1999-2023 -