SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK11024_complete:A_BomoSK_comp12487_c1_seq2
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC101735885_[Bombyx_mori]
Ontology
GO:0000060 P obsolete protein import into nucleus, translocation
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000902 P cell morphogenesis
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001161 F intronic transcription regulatory region sequence-specific DNA binding
GO:0001227 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001953 P negative regulation of cell-matrix adhesion
GO:0002376 P immune system process
GO:0002467 P germinal center formation
GO:0002829 P negative regulation of type 2 immune response
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005657 C replication fork
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006954 P inflammatory response
GO:0006974 P cellular response to DNA damage stimulus
GO:0007266 P Rho protein signal transduction
GO:0007283 P spermatogenesis
GO:0008104 P protein localization
GO:0008285 P negative regulation of cell population proliferation
GO:0030036 P actin cytoskeleton organization
GO:0030183 P B cell differentiation
GO:0030308 P negative regulation of cell growth
GO:0030890 P positive regulation of B cell proliferation
GO:0031065 P positive regulation of histone deacetylation
GO:0031490 F chromatin DNA binding
GO:0032764 P negative regulation of mast cell cytokine production
GO:0035024 P negative regulation of Rho protein signal transduction
GO:0042092 P type 2 immune response
GO:0042127 P regulation of cell population proliferation
GO:0043065 P positive regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043087 P regulation of GTPase activity
GO:0043380 P regulation of memory T cell differentiation
GO:0043565 F sequence-specific DNA binding
GO:0045596 P negative regulation of cell differentiation
GO:0045629 P negative regulation of T-helper 2 cell differentiation
GO:0045666 P positive regulation of neuron differentiation
GO:0045746 P negative regulation of Notch signaling pathway
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048294 P negative regulation of isotype switching to IgE isotypes
GO:0048821 P erythrocyte development
GO:0050727 P regulation of inflammatory response
GO:0051272 P positive regulation of cellular component movement
GO:2000773 P negative regulation of cellular senescence
RNA-seq EntryA_BomoSK_comp12487_c1_seq2
Sequence
(Amino Acid)
MVTMDELKLEIVADSCCVCGNVSDLQSPEEYDTEAPPGQTPLRMMLLHLNNNKVVPEGRL
CSSCIQRTLEAYEFSTALSSSGVPPLSEKIRSLRRKLHELTQKIDVFIVVGGSSLASGGC
YNEEDIIMVDKAALAAAAKADDEELERARNARGDTVYQCTVCPASFQRVSEYRTHVESHG
RAASHACWTCGAQFATRTALHDHLASHADTTDNTCYVCGTTFQVNLNIGNCDCWSHPVNV
CKVDVGRSMIL
*(83 a.a.)

- SilkBase 1999-2023 -