| Name | O_BomoSK1088_internal:A_BomoSK_comp3872_c0_seq2 |
| Scaffold_id | Bomo_Chr23 |
NCBI non-redundant
(nr) | Pleiotropic_regulator_1_[Papilio_machaon] |
| Ontology |
| GO:0000398 |
P |
mRNA splicing, via spliceosome |
| GO:0000974 |
C |
Prp19 complex |
| GO:0003674 |
F |
molecular_function |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005662 |
C |
DNA replication factor A complex |
| GO:0005681 |
C |
spliceosomal complex |
| GO:0005730 |
C |
nucleolus |
| GO:0006397 |
P |
mRNA processing |
| GO:0008380 |
P |
RNA splicing |
| GO:0016607 |
C |
nuclear speck |
| GO:0031965 |
C |
nuclear membrane |
| GO:0034504 |
P |
protein localization to nucleus |
| GO:0071011 |
C |
precatalytic spliceosome |
| GO:0071013 |
C |
catalytic step 2 spliceosome |
| GO:0080008 |
C |
Cul4-RING E3 ubiquitin ligase complex |
| GO:1900087 |
P |
positive regulation of G1/S transition of mitotic cell cycle |
|
| RNA-seq Entry | A_BomoSK_comp3872_c0_seq2 |
Sequence
(Amino Acid) | LMRVISGHLGWVRCVAVEPGNEWFATGAADRVIKVWDLASGKLKVSLTGHVSTVRGVVVS
PRHPYLFSCGEDRQVKCWDLEYNKVIRQYHGHLSAVVCLALHPRLDVLVSAG
(36 a.a.) |
