SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK10863_3prime_partial:A_BomoSK_comp12401_c0_seq2
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
PREDICTED:_LOW_QUALITY_PROTEIN:_protein_numb-like_[Plutella_xylostella]
Ontology
GO:0000166 F nucleotide binding
GO:0001709 P cell fate determination
GO:0003676 F nucleic acid binding
GO:0005112 F Notch binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005938 C cell cortex
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007400 P neuroblast fate determination
GO:0007405 P neuroblast proliferation
GO:0007417 P central nervous system development
GO:0007419 P ventral cord development
GO:0007422 P peripheral nervous system development
GO:0007507 P heart development
GO:0007622 P rhythmic behavior
GO:0008104 P protein localization
GO:0008347 P glial cell migration
GO:0008356 P asymmetric cell division
GO:0008593 P regulation of Notch signaling pathway
GO:0009786 P regulation of asymmetric cell division
GO:0016360 P sensory organ precursor cell fate determination
GO:0035050 P embryonic heart tube development
GO:0042694 P muscle cell fate specification
GO:0045035 P sensory organ precursor cell division
GO:0045165 P cell fate commitment
GO:0045178 C basal part of cell
GO:0045180 C basal cortex
GO:0045746 P negative regulation of Notch signaling pathway
GO:0045807 P positive regulation of endocytosis
GO:0050767 P regulation of neurogenesis
GO:0051642 P centrosome localization
GO:0051960 P regulation of nervous system development
GO:0055059 P asymmetric neuroblast division
GO:0061320 P pericardial nephrocyte differentiation
GO:0061382 P Malpighian tubule tip cell differentiation
RNA-seq EntryA_BomoSK_comp12401_c0_seq2
Sequence
(Amino Acid)
MERLRRSFRESFRRRKGSPPESARPHQWHADEAAVRAGTCTFPVKYLGCVEVFESRGMQV
CEEALKVLRNSRRRPIRAVLHVSGDGLRVVEEETKGLIVDQTIEKVSFCAPDRNHERGFS
YICRDGTTRRWMCHGFLASRDSGERLSHAVGCAFAACLERKQRRDKECAVSMSIDAASHA
FTRQGSFRKSVIISSSNRRASESEPPPPPPVAPA
(70 a.a.)

- SilkBase 1999-2023 -