SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK10834_5prime_partial:A_BomoSK_comp12384_c0_seq2
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
THO_complex_subunit_1_[Papilio_xuthus]
Ontology
GO:0000018 P regulation of DNA recombination
GO:0000346 C transcription export complex
GO:0000347 C THO complex
GO:0000445 C THO complex part of transcription export complex
GO:0000784 C chromosome, telomeric region
GO:0003677 F DNA binding
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006369 P termination of RNA polymerase II transcription
GO:0006396 P RNA processing
GO:0006397 P mRNA processing
GO:0006405 P RNA export from nucleus
GO:0006406 P mRNA export from nucleus
GO:0006810 P transport
GO:0006915 P apoptotic process
GO:0007165 P signal transduction
GO:0008380 P RNA splicing
GO:0016363 C nuclear matrix
GO:0016607 C nuclear speck
GO:0031124 P mRNA 3'-end processing
GO:0031297 P replication fork processing
GO:0032784 P regulation of DNA-templated transcription, elongation
GO:0032786 P positive regulation of DNA-templated transcription, elongation
GO:0045171 C intercellular bridge
GO:0046784 P viral mRNA export from host cell nucleus
GO:0048297 P negative regulation of isotype switching to IgA isotypes
GO:0051028 P mRNA transport
GO:2000002 P negative regulation of DNA damage checkpoint
RNA-seq EntryA_BomoSK_comp12384_c0_seq2
Sequence
(Amino Acid)
TAEGGWGWRALRLLARRSPHFFVQTNNPIGRLPDYLDAMVHRITNEMAANAAAATTEQSP
KSDDKANKPDVTEEEISEEQMEADLIKEGDANDIEQVPDSTHVGDDDYEKSSRSRVTMIT
PAQLDAVSAQLSDWKTLAVKLGYKPDEIQYFETENATDVTRAKNMLQLWFDDDEDASVEN
LLYTMEGLKMTEACEALRRVI
*(66 a.a.)

- SilkBase 1999-2023 -