| Name | O_BomoSK1081_internal:A_BomoSK_comp3867_c0_seq1 |
| Scaffold_id | Bomo_Chr23 |
NCBI non-redundant
(nr) | PREDICTED:_exocyst_complex_component_1_[Bombyx_mori] |
| Ontology |
| GO:0000145 |
C |
exocyst |
| GO:0005546 |
F |
phosphatidylinositol-4,5-bisphosphate binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005886 |
C |
plasma membrane |
| GO:0006810 |
P |
transport |
| GO:0006887 |
P |
exocytosis |
| GO:0006893 |
P |
Golgi to plasma membrane transport |
| GO:0015031 |
P |
protein transport |
| GO:0016020 |
C |
membrane |
| GO:0017049 |
F |
small GTPase binding |
| GO:0048015 |
P |
phosphatidylinositol-mediated signaling |
| GO:0050714 |
P |
positive regulation of protein secretion |
| GO:0051601 |
P |
exocyst localization |
| GO:0061024 |
P |
membrane organization |
| GO:0098592 |
C |
cytoplasmic side of apical plasma membrane |
|
| RNA-seq Entry | A_BomoSK_comp3867_c0_seq1 |
Sequence
(Amino Acid) | AGEAARGALLAAPDHAVDHILDQVLSLVETLCNAEQDFCTQFFFLDVDVKSEGSDGERSE
GGGEGRVRQGAESRRLMAELFPSVEQELVALVGHVERHDAYGAMRALACVG
(36 a.a.) |
