SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK1066_internal:A_BomoSK_comp3853_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
PREDICTED:_frizzled-2-like_[Bombyx_mori]
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006898 P receptor-mediated endocytosis
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007411 P axon guidance
GO:0007435 P salivary gland morphogenesis
GO:0008045 P motor neuron axon guidance
GO:0008407 P chaeta morphogenesis
GO:0008585 P female gonad development
GO:0008587 P imaginal disc-derived wing margin morphogenesis
GO:0010906 P regulation of glucose metabolic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0016201 P synaptic target inhibition
GO:0016477 P cell migration
GO:0017147 F Wnt-protein binding
GO:0030139 C endocytic vesicle
GO:0030165 F PDZ domain binding
GO:0031290 P retinal ganglion cell axon guidance
GO:0035206 P regulation of hemocyte proliferation
GO:0035567 P non-canonical Wnt signaling pathway
GO:0042813 F Wnt-activated receptor activity
GO:0048675 P axon extension
GO:0050808 P synapse organization
GO:0060070 P canonical Wnt signaling pathway
RNA-seq EntryA_BomoSK_comp3853_c0_seq1
Sequence
(Amino Acid)
SAAPGLRPPACLQPCRGAFFTADEKHFAAVWVALWSGLCAASTLMTLTTFLIDSQRFKYP
ERPIVYLSACYFMVSLGYLARLALGHDEIACDGPALKVSASGPSACTLVFILVYFFGMAS
SIWWVVLSFAWFLAAGLKWGNEAIAGYAQYYHLAAWLVPAAKTVAVLLAGAVDGDPVAGI
CSVGNSSPENLKKFVLAPLVVYFGLGATFLLAGFVSLFRIRSVIKRQGGVGAGSKADKLE
KLMIRIGVFSVLYAVPAGAVLACLAYEAAGHA
(89 a.a.)

- SilkBase 1999-2023 -