SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK10577_complete:A_BomoSK_comp12249_c0_seq1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		ATP-dependent_RNA_helicase_DDX54-like_protein_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003676 F nucleic acid binding
GO:0003714 F transcription corepressor activity
GO:0003723 F RNA binding
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0005102 F signaling receptor binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006396 P RNA processing
GO:0010501 P RNA secondary structure unwinding
GO:0016020 C membrane
GO:0016070 P RNA metabolic process
GO:0016787 F hydrolase activity
GO:0016818 F hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0030331 F estrogen receptor binding
GO:0030520 P intracellular estrogen receptor signaling pathway
GO:0044822 F RNA binding
GO:1903507 P negative regulation of nucleic acid-templated transcription
RNA-seq EntryA_BomoSK_comp12249_c0_seq1
Sequence
(Amino Acid)
MLKPKELDDHLPGFDAPKADEPQNEPKNNQKKKKSSGAFQSMGLSFPVLKGITKRGYKQP
TPIQRKTIPIALTGKDVVAMARTGSGKTACFVLPILEKLLVPNNKPTPGKNLRALILSPT
RELALQVNFRFTGID
*(44 a.a.)

- SilkBase 1999-2023 -