SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK10468_3prime_partial:A_BomoSK_comp12209_c0_seq1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
PREDICTED:_v-src_sarcoma_(Schmidt-Ruppin_A-2)_viral_oncogene_homolog_isoform_X3_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001162 F RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding
GO:0003682 F chromatin binding
GO:0003713 F transcription coactivator activity
GO:0004402 F histone acetyltransferase activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005791 C rough endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005874 C microtubule
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007623 P circadian rhythm
GO:0008134 F transcription factor binding
GO:0008584 P male gonad development
GO:0010906 P regulation of glucose metabolic process
GO:0014069 C postsynaptic density
GO:0015721 P bile acid and bile salt transport
GO:0016573 P histone acetylation
GO:0016922 F nuclear receptor binding
GO:0021549 P cerebellum development
GO:0030165 F PDZ domain binding
GO:0030331 F estrogen receptor binding
GO:0030374 F nuclear receptor coactivator activity
GO:0030375 F obsolete thyroid hormone receptor coactivator activity
GO:0030425 C dendrite
GO:0030522 P intracellular receptor signaling pathway
GO:0032403 F protein-containing complex binding
GO:0032870 P cellular response to hormone stimulus
GO:0032922 P circadian regulation of gene expression
GO:0033142 F progesterone receptor binding
GO:0035257 F nuclear receptor binding
GO:0035259 F glucocorticoid receptor binding
GO:0042974 F retinoic acid receptor binding
GO:0043025 C neuronal cell body
GO:0043197 C dendritic spine
GO:0044255 P cellular lipid metabolic process
GO:0045475 P locomotor rhythm
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045925 P positive regulation of female receptivity
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046965 F retinoid X receptor binding
GO:0046966 F thyroid hormone receptor binding
GO:0046983 F protein dimerization activity
GO:0048511 P rhythmic process
GO:0048786 C presynaptic active zone
GO:0070182 F DNA polymerase binding
GO:1904017 P cellular response to Thyroglobulin triiodothyronine
GO:2000273 P positive regulation of signaling receptor activity
GO:2000324 P positive regulation of glucocorticoid receptor signaling pathway
RNA-seq EntryA_BomoSK_comp12209_c0_seq1
Sequence
(Amino Acid)
MPVPGIEDARIESCDLQLGDTWRGMQGKMSVTAPVKKIRKKSDNTQQTQINKCQNEKERR
KLENETINQLEELLGTCLAEVKQPDKNGIVREATRQIQEVLKRRRECPSECPLRSPQCLS
PVQAGEISSTQPQLPCTGLHYSEVTTLIEALKHYTNNLGWVLLEINSKGEIECVSDNIKE
FILHDRTELYRKSIFSILHEKDHAKLRPLLRNIQSFNWDSADIDKFHFVKARLLVKNSNG
TDCGVYVETVIHAAPVRGSSSEEAGSVMCVIRRCDDASAVLIPDDGGPPAITAKQSDHIV
FRLDCNFNILSCDLSAVDSIVNSPVSLVGTRYLDLVDSVDRLRVAAHLLEAASAPAPPAV
SEPFRLRVTPDHPWLRVSARSRLFRSQATSGEPDFIMSTHSVLCDEEIDMLESESPRPAV
GGPLMPSVTNGESSMCESRYRSPVSPATNPFSINDFEFEPWASSLLGEMSNEDSKEPKDG
SVEGPPSTPLTPRAPSTPGESAHVVQPPEEPNRLRTLLSKKPNSSSEANSNSNNRILKDL
LKQEDEEATGSETSAPHTPHTPMTPHTPHTP
(189 a.a.)

- SilkBase 1999-2023 -