SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoSK10374_complete:A_BomoSK_comp12172_c0_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		fringe_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0001708 P cell fate specification
GO:0001745 P compound eye morphogenesis
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005795 C Golgi stack
GO:0005797 C Golgi medial cisterna
GO:0006004 P fucose metabolic process
GO:0006493 P protein O-linked glycosylation
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007293 P germarium-derived egg chamber formation
GO:0007389 P pattern specification process
GO:0007450 P dorsal/ventral pattern formation, imaginal disc
GO:0007451 P dorsal/ventral lineage restriction, imaginal disc
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0008194 F UDP-glycosyltransferase activity
GO:0008375 F acetylglucosaminyltransferase activity
GO:0008587 P imaginal disc-derived wing margin morphogenesis
GO:0008593 P regulation of Notch signaling pathway
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0030173 C integral component of Golgi membrane
GO:0033829 F O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity
GO:0035017 P cuticle pattern formation
GO:0036011 P imaginal disc-derived leg segmentation
GO:0036099 P female germ-line stem cell population maintenance
GO:0045746 P negative regulation of Notch signaling pathway
GO:0045747 P positive regulation of Notch signaling pathway
GO:0046872 F metal ion binding
GO:0048190 P wing disc dorsal/ventral pattern formation
GO:0048477 P oogenesis
GO:0048749 P compound eye development
RNA-seq EntryA_BomoSK_comp12172_c0_seq1
Sequence
(Amino Acid)
MGGRRMLKAAAVLLALGYCSLLVYQGGVNFNFQESRAGVVQVADLSIESITKTSVDDIEL
NKNITLNDIFISVKTTKHYQYTRLPIILKTWFQLAKEQTWFFTDTETKQHQNQTNGHMVN
TNCSASHQRKHLCCKMSVEYDRFLESGKKWFCHFDDDNYVNVPRLVSVLQTYKHQEDWYL
GRTSVYEPVKIYKKPTNKLMFSFWFATGGAGFCISRSLALKMLPVASGGRFISICEGIRL
PDDVSIGFIIEHLMKKNLTLVPEFHSHLEQMKLLPPETFRDQISFSYAKAKDEWNVVNVP
GFDTRYDPTRFLSLHCFLFPHFKFCPR
*(108 a.a.)

- SilkBase 1999-2023 -