Name | O_BomoSK10317_complete:A_BomoSK_comp12142_c0_seq2 |
Scaffold_id | Bomo_Chr21 |
NCBI non-redundant (nr) | cytochrome_P450_Cyp6b29_[Bombyx_mandarina] |
Ontology |
GO:0004497 |
F |
monooxygenase activity |
GO:0005506 |
F |
iron ion binding |
GO:0005783 |
C |
endoplasmic reticulum |
GO:0005789 |
C |
endoplasmic reticulum membrane |
GO:0016020 |
C |
membrane |
GO:0016491 |
F |
oxidoreductase activity |
GO:0016705 |
F |
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
GO:0020037 |
F |
heme binding |
GO:0031090 |
C |
organelle membrane |
GO:0043231 |
C |
intracellular membrane-bounded organelle |
GO:0046872 |
F |
metal ion binding |
GO:0055114 |
P |
obsolete oxidation-reduction process |
GO:0070330 |
F |
aromatase activity |
|
RNA-seq Entry | A_BomoSK_comp12142_c0_seq2 |
Sequence (Amino Acid) | MAIIYILSASVVLPLLLYLYFTRHFNYWKKRNVPGPKPVPLFGNLMELALRKKNIGIVFK
ELYENFPNEKVVGIYRMTTPCLLIRDLDVIKNIMIKDFDVFVDRGVELS
*(35 a.a.) |