SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK10239_complete:A_BomoSK_comp12104_c0_seq4
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
Mitogen-activated_protein_kinase_kinase_kinase_7_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0002376 P immune system process
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004706 F JUN kinase kinase kinase activity
GO:0004709 F MAP kinase kinase kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005575 C cellular_component
GO:0005737 C cytoplasm
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006952 P defense response
GO:0006955 P immune response
GO:0006963 P positive regulation of antibacterial peptide biosynthetic process
GO:0006964 P positive regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria
GO:0007165 P signal transduction
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0007254 P JNK cascade
GO:0007256 P obsolete activation of JNKK activity
GO:0007391 P dorsal closure
GO:0010506 P regulation of autophagy
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016318 P ommatidial rotation
GO:0016740 F transferase activity
GO:0031625 F ubiquitin protein ligase binding
GO:0045087 P innate immune response
GO:0046330 P positive regulation of JNK cascade
GO:0046872 F metal ion binding
GO:0048749 P compound eye development
GO:0048802 P notum morphogenesis
GO:0050829 P defense response to Gram-negative bacterium
GO:0051607 P defense response to virus
GO:0071222 P cellular response to lipopolysaccharide
RNA-seq EntryA_BomoSK_comp12104_c0_seq4
Sequence
(Amino Acid)
MPQTDCSVQVSFKVQQDFDKFQVYVDVFMSNSSSSTGGEGGAPASEPDPALDSMHMMLDP
HLRPISPDLSNEESKRIFEKHKQLAQEYLKIQTELAYLSNHKTELEEKMDDDELRQKREM
IQLENEKESLIKLYCSLNKQLARAENDSWLHSEEMPHE
*(52 a.a.)

- SilkBase 1999-2023 -