| Name | O_BomoSK10234_5prime_partial:A_BomoSK_comp12104_c0_seq1 |
| Scaffold_id | Bomo_Chr3 |
NCBI non-redundant (nr) | putative_Mitogen-activated_protein_kinase_kinase_kinase_7_[Operophtera_brumata] |
| Ontology |
| GO:0000165 |
P |
MAPK cascade |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000186 |
P |
obsolete activation of MAPKK activity |
| GO:0000287 |
F |
magnesium ion binding |
| GO:0004672 |
F |
protein kinase activity |
| GO:0004674 |
F |
protein serine/threonine kinase activity |
| GO:0004709 |
F |
MAP kinase kinase kinase activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005886 |
C |
plasma membrane |
| GO:0006351 |
P |
transcription, DNA-templated |
| GO:0006355 |
P |
regulation of transcription, DNA-templated |
| GO:0006468 |
P |
protein phosphorylation |
| GO:0006915 |
P |
apoptotic process |
| GO:0007165 |
P |
signal transduction |
| GO:0007252 |
P |
I-kappaB phosphorylation |
| GO:0016020 |
C |
membrane |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0043507 |
P |
positive regulation of JUN kinase activity |
| GO:0046872 |
F |
metal ion binding |
|
| RNA-seq Entry | A_BomoSK_comp12104_c0_seq1 |
Sequence (Amino Acid) | VHSSARRTVSARGRAMPPLPAPPARFRRIDACDATTGIVTTIRDAVSCSWIFYSNSSSST
GGEGGAPASEPDPALDSMHMMLDPHLRPISPDLSNEESKRIFEKHKQLAQEYLKIQTELA
YLSNHKTELEEKMDDDELRQKREMIQLENEKESLIKLYCSLNKQLARAENDSWLHSEEMP
HE
*(60 a.a.) |