SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK10155_5prime_partial:A_BomoSK_comp12062_c0_seq1
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)
presenilin_isoform_B_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0001708 P cell fate specification
GO:0004175 F endopeptidase activity
GO:0004190 F aspartic-type endopeptidase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005887 C integral component of plasma membrane
GO:0005938 C cell cortex
GO:0006509 P membrane protein ectodomain proteolysis
GO:0006816 P calcium ion transport
GO:0007219 P Notch signaling pathway
GO:0007220 P Notch receptor processing
GO:0007399 P nervous system development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016048 P detection of temperature stimulus
GO:0016324 C apical plasma membrane
GO:0016485 P protein processing
GO:0017015 P regulation of transforming growth factor beta receptor signaling pathway
GO:0018991 P oviposition
GO:0030018 C Z disc
GO:0042987 P amyloid precursor protein catabolic process
GO:0043025 C neuronal cell body
GO:0043066 P negative regulation of apoptotic process
GO:0045176 P apical protein localization
GO:0045747 P positive regulation of Notch signaling pathway
GO:0048471 C perinuclear region of cytoplasm
GO:0048563 P post-embryonic animal organ morphogenesis
GO:0050435 P amyloid-beta metabolic process
GO:0070765 C gamma-secretase complex
RNA-seq EntryA_BomoSK_comp12062_c0_seq1
Sequence
(Amino Acid)
PRYVTRLDPPHAPHAPPHAPDLDEEKGVKLGLGDFIFYSVLVGKASSYGDWNTTLACFVA
ILIGLCLTLLLLAILKKALPALPISITFGLIFYFATRSVVKPFADALAAEQVFI
*(37 a.a.)

- SilkBase 1999-2023 -