SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoSK10133_3prime_partial:A_BomoSK_comp12059_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
PREDICTED:_ATP-dependent_helicase_brm_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003713 F transcription coactivator activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006909 P phagocytosis
GO:0007275 P multicellular organism development
GO:0007406 P negative regulation of neuroblast proliferation
GO:0007409 P axonogenesis
GO:0007419 P ventral cord development
GO:0007474 P imaginal disc-derived wing vein specification
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007517 P muscle organ development
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0008587 P imaginal disc-derived wing margin morphogenesis
GO:0016568 P chromatin organization
GO:0016787 F hydrolase activity
GO:0016817 F hydrolase activity, acting on acid anhydrides
GO:0016887 F ATP hydrolysis activity
GO:0022008 P neurogenesis
GO:0035060 C brahma complex
GO:0035172 P hemocyte proliferation
GO:0035329 P hippo signaling
GO:0036335 P intestinal stem cell homeostasis
GO:0042393 F histone binding
GO:0043044 P chromatin remodeling
GO:0043974 P histone H3-K27 acetylation
GO:0045088 P regulation of innate immune response
GO:0045742 P positive regulation of epidermal growth factor receptor signaling pathway
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0048096 P epigenetic maintenance of chromatin in transcription-competent conformation
GO:0048477 P oogenesis
GO:0048666 P neuron development
GO:0048813 P dendrite morphogenesis
GO:0070604 C RSC-type complex
GO:0070983 P dendrite guidance
GO:2000134 P negative regulation of G1/S transition of mitotic cell cycle
GO:2000648 P positive regulation of stem cell proliferation
RNA-seq EntryA_BomoSK_comp12059_c0_seq1
Sequence
(Amino Acid)
MASPSPQSSPMPPPQAPSPMGPPTQSPAPPHSPHSPYNQHVNGPPSSHPSSGGPPSISNH
MPPSGAIAANANGPPGVSQQHPGLPSGHQMPPHMVGPHMSGPPSHQPHPPGPNGHPNMPG
GPQHSNIAAQGPPHGYLQHQMGHMPPGQGQLPMGGAPPSGNGPQGPLGGPMPMGGPPTHG
VHPGQGMPPGAPGHMPSHHSMMPGQGPPPHGANTGPYGHPPQAGSTPPAQSGGQPTSGGA
STTGPMQHPPSAQTPPHGQGPPQSSSSNGAPPSSSPMQGSLPVTGPDNLNALQRAIDSME
EKGLQEDPRYSQLLALRARSNPQDPSKGLFSNTQLCQLKAQISAYRNLARNQPLPPQVAA
LATGKRTGESPPECPTPPASGAYGEA
(127 a.a.)

- SilkBase 1999-2023 -