SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK5406_internal:A_BomoOtmSK_comp10335_c1_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
phosphatidylinositol_4,5-bisphosphate_3-kinase_catalytic_subunit_delta_isoform_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001525 P angiogenesis
GO:0001889 P liver development
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0005942 C phosphatidylinositol 3-kinase complex
GO:0005943 C phosphatidylinositol 3-kinase complex, class IA
GO:0006006 P glucose metabolic process
GO:0006468 P protein phosphorylation
GO:0006909 P phagocytosis
GO:0010468 P regulation of gene expression
GO:0016301 F kinase activity
GO:0016303 F 1-phosphatidylinositol-3-kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0016773 F phosphotransferase activity, alcohol group as acceptor
GO:0030027 C lamellipodium
GO:0030295 F protein kinase activator activity
GO:0032147 P activation of protein kinase activity
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0035004 F phosphatidylinositol 3-kinase activity
GO:0035005 F 1-phosphatidylinositol-4-phosphate 3-kinase activity
GO:0036092 P phosphatidylinositol-3-phosphate biosynthetic process
GO:0040014 P regulation of multicellular organism growth
GO:0043457 P regulation of cellular respiration
GO:0043491 P protein kinase B signaling
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043560 F insulin receptor substrate binding
GO:0044029 P hypomethylation of CpG island
GO:0046854 P phosphatidylinositol phosphate biosynthetic process
GO:0046934 F phosphatidylinositol-4,5-bisphosphate 3-kinase activity
GO:0048015 P phosphatidylinositol-mediated signaling
GO:0060612 P adipose tissue development
GO:0071333 P cellular response to glucose stimulus
GO:0097009 P energy homeostasis
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
GO:2000270 P negative regulation of fibroblast apoptotic process
GO:2000653 P regulation of genetic imprinting
GO:2000811 P negative regulation of anoikis
RNA-seq EntryA_BomoOtmSK_comp10335_c1_seq1
Sequence
(Amino Acid)
AMWTLVADDTQGDDMVLHPLGTVVANPTPDSAVLQVMFSNYDCQYPILFPKQETVMAYSD
HIESVSPDLMDRLCRDFERLRIIAEKDPMYEMHEQEKKDIWASRERFRVETPELLPKLLS
CVEWGERTQASSVPRMLDEW
(45 a.a.)

- SilkBase 1999-2023 -