SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK5198_5prime_partial:A_BomoOtmSK_comp10166_c1_seq1
Scaffold_idBomo_Chr14
NCBI non-redundant
(nr)
E3_ubiquitin-protein_ligase_TRIM33_[Bombyx_mori]
Ontology
GO:0002039 F p53 binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003713 F transcription coactivator activity
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004842 F ubiquitin-protein transferase activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005719 C euchromatin
GO:0005726 C perichromatin fibrils
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006468 P protein phosphorylation
GO:0008270 F zinc ion binding
GO:0008285 P negative regulation of cell population proliferation
GO:0010628 P positive regulation of gene expression
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0016922 F nuclear receptor binding
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0030163 P protein catabolic process
GO:0031647 P regulation of protein stability
GO:0034056 F estrogen response element binding
GO:0035064 F methylated histone binding
GO:0042981 P regulation of apoptotic process
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0055074 P calcium ion homeostasis
GO:0061630 F ubiquitin protein ligase activity
GO:0070562 P regulation of vitamin D receptor signaling pathway
GO:0070577 F lysine-acetylated histone binding
GO:0071391 P cellular response to estrogen stimulus
GO:1901796 P regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomoOtmSK_comp10166_c1_seq1
Sequence
(Amino Acid)
SNRITLELYCQYELSLHFREPVPAENLHYHSKIARPMCLDAIRMKLQPGSASRYAHVERF
LADVRLLFRNAYAYNPPDSQVYKDAKRLEEFFDAQLLKWLPEYAYWNGEAEGEAPTKRPR
LD
*(40 a.a.)

- SilkBase 1999-2023 -