SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK5033_5prime_partial:A_BomoOtmSK_comp10036_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		DNA_repair_protein_XRCC2_[Operophtera_brumata]
Ontology
GO:0000150 F DNA strand exchange activity
GO:0000278 P mitotic cell cycle
GO:0000400 F four-way junction DNA binding
GO:0000707 P meiotic DNA recombinase assembly
GO:0000724 P double-strand break repair via homologous recombination
GO:0000731 P DNA synthesis involved in DNA repair
GO:0000732 P strand displacement
GO:0001701 P in utero embryonic development
GO:0001756 P somitogenesis
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003697 F single-stranded DNA binding
GO:0004520 F endodeoxyribonuclease activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005657 C replication fork
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006312 P mitotic recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007126 P meiotic cell cycle
GO:0007131 P reciprocal meiotic recombination
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0010165 P response to X-ray
GO:0010212 P response to ionizing radiation
GO:0010332 P response to gamma radiation
GO:0022008 P neurogenesis
GO:0033063 C Rad51B-Rad51C-Rad51D-XRCC2 complex
GO:0035264 P multicellular organism growth
GO:0042148 P strand invasion
GO:0043524 P negative regulation of neuron apoptotic process
GO:0050769 P positive regulation of neurogenesis
GO:0051297 P centrosome cycle
GO:2000269 P regulation of fibroblast apoptotic process
RNA-seq EntryA_BomoOtmSK_comp10036_c0_seq1
Sequence
(Amino Acid)
SDGKRASFLIIDIICEALVPSELDGPEIGVVLLATDGSISHEKILKVLTQKLLLKISQYN
SNGNLDTTLLDTLLLKSLKNFHLLEVYDATQFYCTLYNFENVVSAYPNISLILIENLVAF
YWSEQGFKIIKMDLYQKKILKIVQTIIKEYKIPVLYYKPQYFHSSKESEDTKIQTINYKI
EVSSNLNDTDIFNVSIFTGSEQEMKYFKIINDQLTWLRGDS
*(73 a.a.)

- SilkBase 1999-2023 -