SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK35791_internal:A_BomoOtmSK_comp1040177_c0_seq1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
teneurin-a_isoform_X1_[Bombyx_mori]
Ontology
GO:0001941 P postsynaptic membrane organization
GO:0003824 F catalytic activity
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005886 C plasma membrane
GO:0007155 P cell adhesion
GO:0007274 P neuromuscular synaptic transmission
GO:0007399 P nervous system development
GO:0008039 P synaptic target recognition
GO:0008152 P metabolic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016200 P synaptic target attraction
GO:0030054 C cell junction
GO:0030424 C axon
GO:0031594 C neuromuscular junction
GO:0034110 P regulation of homotypic cell-cell adhesion
GO:0034116 P positive regulation of heterotypic cell-cell adhesion
GO:0040017 P positive regulation of locomotion
GO:0042734 C presynaptic membrane
GO:0042803 F protein homodimerization activity
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0045202 C synapse
GO:0046982 F protein heterodimerization activity
GO:0048036 P central complex development
GO:0048499 P synaptic vesicle membrane organization
GO:0048786 C presynaptic active zone
GO:0048788 C cytoskeleton of presynaptic active zone
GO:0048790 P maintenance of presynaptic active zone structure
GO:0050808 P synapse organization
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0097090 P presynaptic membrane organization
GO:2000331 P regulation of terminal button organization
RNA-seq EntryA_BomoOtmSK_comp1040177_c0_seq1
Sequence
(Amino Acid)
QTVFPGDGARVVYRYFTTNKVSEVIHGDGQTQIHYSENSGLPSEILHVDRDVDYRWEFTY
IGGLLTEERLDYGAKTGLSNAKIIYEYDSNYRITSVQGRIGGQTLIPYHIVYNSKT
(37 a.a.)

- SilkBase 1999-2023 -