SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK1393_5prime_partial:A_BomoOtmSK_comp4945_c0_seq1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		angiomotin_[Bombyx_mori]
Ontology
GO:0001570 P vasculogenesis
GO:0001701 P in utero embryonic development
GO:0001702 P gastrulation with mouth forming second
GO:0001725 C stress fiber
GO:0001726 C ruffle
GO:0003365 P establishment of cell polarity involved in ameboidal cell migration
GO:0004872 F signaling receptor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005884 C actin filament
GO:0005923 C bicellular tight junction
GO:0006935 P chemotaxis
GO:0008180 C COP9 signalosome
GO:0009897 C external side of plasma membrane
GO:0009986 C cell surface
GO:0016021 C integral component of membrane
GO:0016525 P negative regulation of angiogenesis
GO:0030027 C lamellipodium
GO:0030036 P actin cytoskeleton organization
GO:0030054 C cell junction
GO:0030139 C endocytic vesicle
GO:0030334 P regulation of cell migration
GO:0031410 C cytoplasmic vesicle
GO:0034260 P negative regulation of GTPase activity
GO:0034613 P cellular protein localization
GO:0035329 P hippo signaling
GO:0040019 P positive regulation of embryonic development
GO:0042074 P cell migration involved in gastrulation
GO:0043116 P negative regulation of vascular permeability
GO:0043532 F angiostatin binding
GO:0043534 P blood vessel endothelial cell migration
GO:0043536 P positive regulation of blood vessel endothelial cell migration
GO:0048514 P blood vessel morphogenesis
GO:0051056 P regulation of small GTPase mediated signal transduction
RNA-seq EntryA_BomoOtmSK_comp4945_c0_seq1
Sequence
(Amino Acid)
AGGEAELRRQLRERDERLLALEGECAKWEQRYLEEAALRQAAVSAASIPKDAKIAALEKT
SAESERLMAEARSEKIRHMDELHSAQKKVADLESRVKELESKVAERDAMIKVLQKHTSAA
YEAGGASLRNHSSREELVALSSGASFSSAEGVTGRYRNLTRRNYSPHNDNSSGIGFESSS
LRLEEQLAALDSRLERAPVPAVSYRHPQHDYY
*(70 a.a.)

- SilkBase 1999-2023 -