SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK13547_5prime_partial:A_BomoOtmSK_comp14711_c2_seq1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		E3_ubiquitin-protein_ligase_MYLIP_[Bombyx_mori]
Ontology
GO:0004842 F ubiquitin-protein transferase activity
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0007399 P nervous system development
GO:0008092 F cytoskeletal protein binding
GO:0008270 F zinc ion binding
GO:0010989 P negative regulation of low-density lipoprotein particle clearance
GO:0016020 C membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0019898 C extrinsic component of membrane
GO:0031648 P protein destabilization
GO:0032803 P regulation of low-density lipoprotein particle receptor catabolic process
GO:0042632 P cholesterol homeostasis
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0045732 P positive regulation of protein catabolic process
GO:0046872 F metal ion binding
GO:0061630 F ubiquitin protein ligase activity
RNA-seq EntryA_BomoOtmSK_comp14711_c2_seq1
Sequence
(Amino Acid)
AAPTAAPTAAPPARVGHEKTRSRSSSSSSSSGGGGEALACRVCMDEPIDSLFLPCRHVVC
CGQCAPRCNRCPLCRGEIEKLMHIFLPMEYQKNPGLIVK
*(32 a.a.)

- SilkBase 1999-2023 -