SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK12927_3prime_partial:A_BomoOtmSK_comp14488_c0_seq1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)		transcription_factor_EB,_partial_[Helicoverpa_armigera]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0006461 P protein-containing complex assembly
GO:0007275 P multicellular organism development
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0016055 P Wnt signaling pathway
GO:0030154 P cell differentiation
GO:0030316 P osteoclast differentiation
GO:0030318 P melanocyte differentiation
GO:0042127 P regulation of cell population proliferation
GO:0042981 P regulation of apoptotic process
GO:0043010 P camera-type eye development
GO:0043066 P negative regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0043473 P pigmentation
GO:0043565 F sequence-specific DNA binding
GO:0044336 P canonical Wnt signaling pathway involved in negative regulation of apoptotic process
GO:0045165 P cell fate commitment
GO:0045670 P regulation of osteoclast differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046849 P bone remodeling
GO:0046983 F protein dimerization activity
GO:0097531 P mast cell migration
GO:2000144 P positive regulation of DNA-templated transcription, initiation
GO:2001141 P regulation of RNA biosynthetic process
RNA-seq EntryA_BomoOtmSK_comp14488_c0_seq1
Sequence
(Amino Acid)
MDESGIDMGFDLASFLTNDFSVDQRILEDMTAAQQHQDFMFYELKSKAVPITESPPTFKT
LTPTSRTQLKQQLMREHAQEQLRRESQNQQAGQSKDNEEHKKKSSPTEVPRITPHVELPP
QVLQVRTVLENPTRYHVIQKQKSQVRQYLSESFQ
(50 a.a.)

- SilkBase 1999-2023 -