| Name | O_BomoOtmSK12694_3prime_partial:A_BomoOtmSK_comp14406_c0_seq1 |
| Scaffold_id | Bomo_Chr4 |
NCBI non-redundant (nr) | cysteine_protease_ATG4B_[Bombyx_mori] |
| Ontology |
| GO:0000045 |
P |
autophagosome assembly |
| GO:0000422 |
P |
autophagy of mitochondrion |
| GO:0004197 |
F |
cysteine-type endopeptidase activity |
| GO:0005737 |
C |
cytoplasm |
| GO:0005829 |
C |
cytosol |
| GO:0006501 |
P |
C-terminal protein lipidation |
| GO:0006508 |
P |
proteolysis |
| GO:0006612 |
P |
protein targeting to membrane |
| GO:0006810 |
P |
transport |
| GO:0006914 |
P |
autophagy |
| GO:0008233 |
F |
peptidase activity |
| GO:0008234 |
F |
cysteine-type peptidase activity |
| GO:0015031 |
P |
protein transport |
| GO:0016485 |
P |
protein processing |
| GO:0016787 |
F |
hydrolase activity |
| GO:0044804 |
P |
autophagy of nucleus |
| GO:0051697 |
P |
protein delipidation |
|
| RNA-seq Entry | A_BomoOtmSK_comp14406_c0_seq1 |
Sequence (Amino Acid) | MDAVFDMCYLSGADGNNVEPNDIPKTKESIWVLGKKYSAIQDLDRIRRDITSIIWCTYRK
GFVPIGDEGLTSDKGWGCMLRCGQMVLGVALVRVHLSVDWVWSPETSIKFY
(36 a.a.) |