SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK124_3prime_partial:A_BomoOtmSK_comp482_c1_seq1
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)
insulin-like_receptor_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001556 P oocyte maturation
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005010 F insulin-like growth factor-activated receptor activity
GO:0005515 F protein binding
GO:0005520 F insulin-like growth factor binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275 P multicellular organism development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0043548 F phosphatidylinositol 3-kinase binding
GO:0043560 F insulin receptor substrate binding
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0048009 P insulin-like growth factor receptor signaling pathway
GO:0051262 P protein tetramerization
RNA-seq EntryA_BomoOtmSK_comp482_c1_seq1
Sequence
(Amino Acid)
MAENLVLLLLLILSIPVRIQSAKPQSIHGVCRSVTCNSLHDVREKLSDCVVIMGSLQLSI
MERTKKQDFKNISFPNLREVTHFLLVYRVQGLQSLGILFPNLARIRGEVLLNNYALIIYD
MPKLKEIGLYSLLKIDRGGVIIWGLPQACYVDTVDWKIIAP
(52 a.a.)

- SilkBase 1999-2023 -