SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK12208_3prime_partial:A_BomoOtmSK_comp14244_c1_seq1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)		PREDICTED:_cyclin-T-like,_partial_[Amyelois_transitella]
Ontology
GO:0000278 P mitotic cell cycle
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0005703 C polytene chromosome puff
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0007015 P actin filament organization
GO:0007419 P ventral cord development
GO:0008023 C transcription elongation factor complex
GO:0008024 C cyclin/CDK positive transcription elongation factor complex
GO:0008353 F RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0008360 P regulation of cell shape
GO:0009408 P response to heat
GO:0016538 F cyclin-dependent protein serine/threonine kinase regulator activity
GO:0019901 F protein kinase binding
GO:0032783 C super elongation complex
GO:0045737 P positive regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:1901409 P positive regulation of phosphorylation of RNA polymerase II C-terminal domain
RNA-seq EntryA_BomoOtmSK_comp14244_c1_seq1
Sequence
(Amino Acid)
MAGGQEKWYFTKEQLQNSPSRKCGLDADKELAYRQQAANLIQDMGQRLQVSQLCINTAIV
YMHRFYAFHSFTQFHRNAIAAAALFLAAKVEEQPRKLEYVIKVAHVCLHRGEGVNALTPE
QYQEQAQDLVFNENVLLQTLGFDVAIDHPHTHVVRTCHLVKGETSVLMLS
(55 a.a.)

- SilkBase 1999-2023 -