SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK12056_3prime_partial:A_BomoOtmSK_comp14180_c0_seq1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
kinesin-associated_protein_3_[Bombyx_mori]
Ontology
GO:0000794 C condensed nuclear chromosome
GO:0005515 F protein binding
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0005871 C kinesin complex
GO:0005876 C spindle microtubule
GO:0005930 C axoneme
GO:0006461 P protein-containing complex assembly
GO:0006890 P retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0007017 P microtubule-based process
GO:0007018 P microtubule-based movement
GO:0007165 P signal transduction
GO:0008104 P protein localization
GO:0008285 P negative regulation of cell population proliferation
GO:0015630 C microtubule cytoskeleton
GO:0016939 C kinesin II complex
GO:0019886 P antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0019894 F kinesin binding
GO:0030990 C intraciliary transport particle
GO:0032391 C photoreceptor connecting cilium
GO:0036064 C ciliary basal body
GO:0043066 P negative regulation of apoptotic process
GO:0046587 P positive regulation of calcium-dependent cell-cell adhesion
GO:0070062 C extracellular exosome
GO:0072372 C cilium
GO:0072383 P plus-end-directed vesicle transport along microtubule
GO:0097542 C ciliary tip
GO:1990075 C periciliary membrane compartment
RNA-seq EntryA_BomoOtmSK_comp14180_c0_seq1
Sequence
(Amino Acid)
MLLLNVNAESGGSTDVLLALCVNLAWCERAAHQMAAEGRLRELLARAFRYCNSVLMKLVR
NLSHHPQNKPLFLEFVGDIAGAVTSGETSEEFHIECMGTLSNILNPENIDIYAVVERYNL
IPCIMKILDPESGSSEELLLEGVVMAGAVAAESRAAGALVRA
(53 a.a.)

- SilkBase 1999-2023 -