SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK11974_5prime_partial:A_BomoOtmSK_comp14148_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
notch_homolog_isoform_X1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001708 P cell fate specification
GO:0001737 P establishment of imaginal disc-derived wing hair orientation
GO:0001745 P compound eye morphogenesis
GO:0003682 F chromatin binding
GO:0004872 F signaling receptor activity
GO:0004888 F transmembrane signaling receptor activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005770 C late endosome
GO:0005788 C endoplasmic reticulum lumen
GO:0005796 C Golgi lumen
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005912 C adherens junction
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007015 P actin filament organization
GO:0007155 P cell adhesion
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007219 P Notch signaling pathway
GO:0007252 P I-kappaB phosphorylation
GO:0007275 P multicellular organism development
GO:0007293 P germarium-derived egg chamber formation
GO:0007297 P ovarian follicle cell migration
GO:0007298 P border follicle cell migration
GO:0007314 P oocyte anterior/posterior axis specification
GO:0007346 P regulation of mitotic cell cycle
GO:0007391 P dorsal closure
GO:0007398 P ectoderm development
GO:0007399 P nervous system development
GO:0007400 P neuroblast fate determination
GO:0007403 P glial cell fate determination
GO:0007411 P axon guidance
GO:0007419 P ventral cord development
GO:0007422 P peripheral nervous system development
GO:0007423 P sensory organ development
GO:0007424 P open tracheal system development
GO:0007440 P foregut morphogenesis
GO:0007446 P imaginal disc growth
GO:0007447 P imaginal disc pattern formation
GO:0007450 P dorsal/ventral pattern formation, imaginal disc
GO:0007451 P dorsal/ventral lineage restriction, imaginal disc
GO:0007460 P R8 cell fate commitment
GO:0007464 P R3/R4 cell fate commitment
GO:0007473 P wing disc proximal/distal pattern formation
GO:0007474 P imaginal disc-derived wing vein specification
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007478 P leg disc morphogenesis
GO:0007498 P mesoderm development
GO:0007519 P skeletal muscle tissue development
GO:0007521 P muscle cell fate determination
GO:0007615 P anesthesia-resistant memory
GO:0007616 P long-term memory
GO:0008045 P motor neuron axon guidance
GO:0008284 P positive regulation of cell population proliferation
GO:0008340 P determination of adult lifespan
GO:0008347 P glial cell migration
GO:0008356 P asymmetric cell division
GO:0008407 P chaeta morphogenesis
GO:0008587 P imaginal disc-derived wing margin morphogenesis
GO:0009608 P response to symbiont
GO:0009952 P anterior/posterior pattern specification
GO:0009986 C cell surface
GO:0010001 P glial cell differentiation
GO:0010629 P negative regulation of gene expression
GO:0010906 P regulation of glucose metabolic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016330 P second mitotic wave involved in compound eye morphogenesis
GO:0016333 P morphogenesis of follicular epithelium
GO:0016348 P imaginal disc-derived leg joint morphogenesis
GO:0016360 P sensory organ precursor cell fate determination
GO:0022416 P chaeta development
GO:0030139 C endocytic vesicle
GO:0030154 P cell differentiation
GO:0030707 P ovarian follicle cell development
GO:0030708 P germarium-derived female germ-line cyst encapsulation
GO:0030713 P ovarian follicle cell stalk formation
GO:0030718 P germ-line stem cell population maintenance
GO:0030720 P oocyte localization involved in germarium-derived egg chamber formation
GO:0031410 C cytoplasmic vesicle
GO:0035003 C subapical complex
GO:0035153 P epithelial cell type specification, open tracheal system
GO:0035155 P negative regulation of terminal cell fate specification, open tracheal system
GO:0035157 P negative regulation of fusion cell fate specification
GO:0035162 P embryonic hemopoiesis
GO:0035165 P embryonic crystal cell differentiation
GO:0035167 P larval lymph gland hemopoiesis
GO:0035170 P lymph gland crystal cell differentiation
GO:0035171 P lamellocyte differentiation
GO:0035172 P hemocyte proliferation
GO:0035214 P eye-antennal disc development
GO:0035222 P wing disc pattern formation
GO:0036011 P imaginal disc-derived leg segmentation
GO:0036099 P female germ-line stem cell population maintenance
GO:0036335 P intestinal stem cell homeostasis
GO:0040008 P regulation of growth
GO:0042067 P establishment of ommatidial planar polarity
GO:0042676 P compound eye cone cell fate commitment
GO:0042686 P regulation of cardioblast cell fate specification
GO:0042688 P crystal cell differentiation
GO:0042689 P regulation of crystal cell differentiation
GO:0043234 C protein-containing complex
GO:0045165 P cell fate commitment
GO:0045316 P negative regulation of compound eye photoreceptor development
GO:0045463 P R8 cell development
GO:0045465 P R8 cell differentiation
GO:0045466 P R7 cell differentiation
GO:0045468 P regulation of R8 cell spacing in compound eye
GO:0045595 P regulation of cell differentiation
GO:0045747 P positive regulation of Notch signaling pathway
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046329 P negative regulation of JNK cascade
GO:0046331 P lateral inhibition
GO:0046666 P retinal cell programmed cell death
GO:0046667 P compound eye retinal cell programmed cell death
GO:0046843 P dorsal appendage formation
GO:0048052 P R1/R6 cell differentiation
GO:0048190 P wing disc dorsal/ventral pattern formation
GO:0048477 P oogenesis
GO:0048542 P lymph gland development
GO:0048666 P neuron development
GO:0048749 P compound eye development
GO:0048803 P imaginal disc-derived male genitalia morphogenesis
GO:0048863 P stem cell differentiation
GO:0050767 P regulation of neurogenesis
GO:0050768 P negative regulation of neurogenesis
GO:0050793 P regulation of developmental process
GO:0050877 P nervous system process
GO:0051489 P regulation of filopodium assembly
GO:0060250 P germ-line stem-cell niche homeostasis
GO:0060288 P formation of a compartment boundary
GO:0060429 P epithelium development
GO:0061331 P epithelial cell proliferation involved in Malpighian tubule morphogenesis
GO:0061382 P Malpighian tubule tip cell differentiation
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
GO:2000048 P negative regulation of cell-cell adhesion mediated by cadherin
RNA-seq EntryA_BomoOtmSK_comp14148_c0_seq1
Sequence
(Amino Acid)
IRLWRCDIHDHNAKGGYGSPITGIFSNKNPGLTLEELDLAFQREQCVKKGCKEKQGDHHC
DEECNTYACEFDGNDCSLGINPWANCTAPINCWEVFMNGECNEVCNTQACLFDGRDCQKS
LQRCNPIYDAYCQKHYANGHCDYGCNNAECNWDGLDCENEPPDLAEGVMSVILLMDMKTF
KENSVAFLRDLGHQLRTTVLIKKDHLGNDMVLPWKGSTDVGLEETEFGKKHHIVYTERGQ
SGVQVYLELDNRKCTTMLSSECFFSAREAADFLAATASKHSLSPDFPIYQVKGVNPPITD
EVPTNSKYVFIGVILVLLAGLLIGVLVTAQRKRAAGITWFPEGFIRSNSSTRRRSRRRGP
DGQEMRNLNKGSIGCIDVDINGGHMGPPHSWSDEDDDGSAPPRAKRARGPGDANGAPGGY
ASDHTAITDYEEAGHEPRVWTQQHLDAADIRVPPSMMTPPAIHDSHVDVDVRGPLGMTPL
MVAAVRGGGLDTGSDVEDEQTAHIISELVAQGAQLNAAMDKTGETSLHLAARYARADAAK
RLLDAGADANSQDNTGRTPLHAAVAADAMGVFQILLRNRATNLNARMHDGTTPLILAARL
AIEGMVEDLINADADINAADNSGKTALHWAAAVNNVDAVNVLLAHGANRDAQDDKDETPL
FLGAREGSYGACRALLDAMANREITDHMDRLPRDVAQERMHDDIVRLLDEHCPRPPPQHP
HLMTSPNPHHQLISQPTVIASAAKGKPKKPRAKAGPDSPQDQVYDNNNLQQTQIRRKPSV
KKSNKKIAQEVPQSVESLGSSLSPVESPLQNLQDLPSPYDATSLYSNTMAQFVGMEQLLH
HKQPPSYEDCVKTGQTLQQSYGGGAMGASLSPPYSNHSPTHSNQTTSPHAYMGSPSPGKS
RPSLPTSPAHMAALRHSHQHQLDAYSALAHLSASSQHNAQLQAVMTHAAALGQVQGAQHP
ALTNLMSGLYSWHTGMGDTFPTPSPESPDHWSTPSPQTPLTQSPHSDWSDRAALSPNDIQ
QTNKGAEGIYI
*(343 a.a.)

- SilkBase 1999-2023 -