SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK11816_3prime_partial:A_BomoOtmSK_comp14072_c0_seq2
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		DNA_repair_protein_XRCC1_isoform_X3_[Bombyx_mori]
Ontology
GO:0000012 P single strand break repair
GO:0000724 P double-strand break repair via homologous recombination
GO:0001666 P response to hypoxia
GO:0003684 F damaged DNA binding
GO:0003909 F DNA ligase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006281 P DNA repair
GO:0006283 P transcription-coupled nucleotide-excision repair
GO:0006284 P base-excision repair
GO:0006288 P base-excision repair, DNA ligation
GO:0006297 P nucleotide-excision repair, DNA gap filling
GO:0006974 P cellular response to DNA damage stimulus
GO:0010033 P response to organic substance
GO:0019899 F enzyme binding
GO:0042493 P response to xenobiotic stimulus
RNA-seq EntryA_BomoOtmSK_comp14072_c0_seq2
Sequence
(Amino Acid)
MPRVKIDYVVSFSSEDPDHPANNLLALEVNKKKWLCCKGESSCSVVLQLAKAVQISSVYL
GVHHAATVEVLVGRSEKPDEPFEVLVPSSVMLSPSESRRAEGVQRVRAWRGDQ
(36 a.a.)

- SilkBase 1999-2023 -