SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK117_internal:A_BomoOtmSK_comp451_c0_seq1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
PREDICTED:_T-box_transcription_factor_TBX1-like_[Amyelois_transitella]
Ontology
GO:0001525 P angiogenesis
GO:0001568 P blood vessel development
GO:0001708 P cell fate specification
GO:0001755 P neural crest cell migration
GO:0001934 P positive regulation of protein phosphorylation
GO:0001945 P lymph vessel development
GO:0002053 P positive regulation of mesenchymal cell proliferation
GO:0003007 P heart morphogenesis
GO:0003148 P outflow tract septum morphogenesis
GO:0003151 P outflow tract morphogenesis
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007368 P determination of left/right symmetry
GO:0007389 P pattern specification process
GO:0007498 P mesoderm development
GO:0007507 P heart development
GO:0007517 P muscle organ development
GO:0007605 P sensory perception of sound
GO:0008283 P cell population proliferation
GO:0008284 P positive regulation of cell population proliferation
GO:0009952 P anterior/posterior pattern specification
GO:0021644 P vagus nerve morphogenesis
GO:0030855 P epithelial cell differentiation
GO:0030878 P thyroid gland development
GO:0035176 P social behavior
GO:0035909 P aorta morphogenesis
GO:0042471 P ear morphogenesis
GO:0042472 P inner ear morphogenesis
GO:0042473 P outer ear morphogenesis
GO:0042474 P middle ear morphogenesis
GO:0042475 P odontogenesis of dentin-containing tooth
GO:0042693 P muscle cell fate commitment
GO:0042803 F protein homodimerization activity
GO:0043410 P positive regulation of MAPK cascade
GO:0043565 F sequence-specific DNA binding
GO:0043587 P tongue morphogenesis
GO:0044344 P cellular response to fibroblast growth factor stimulus
GO:0045596 P negative regulation of cell differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046983 F protein dimerization activity
GO:0048384 P retinoic acid receptor signaling pathway
GO:0048514 P blood vessel morphogenesis
GO:0048538 P thymus development
GO:0048644 P muscle organ morphogenesis
GO:0048701 P embryonic cranial skeleton morphogenesis
GO:0048703 P embryonic viscerocranium morphogenesis
GO:0048752 P semicircular canal morphogenesis
GO:0048844 P artery morphogenesis
GO:0050679 P positive regulation of epithelial cell proliferation
GO:0060017 P parathyroid gland development
GO:0060023 P soft palate development
GO:0060037 P pharyngeal system development
GO:0060325 P face morphogenesis
GO:0060415 P muscle tissue morphogenesis
GO:0060982 P coronary artery morphogenesis
GO:0070166 P enamel mineralization
GO:0071300 P cellular response to retinoic acid
GO:0090103 P cochlea morphogenesis
GO:0097152 P mesenchymal cell apoptotic process
GO:2000027 P regulation of animal organ morphogenesis
GO:2001037 P positive regulation of tongue muscle cell differentiation
GO:2001054 P negative regulation of mesenchymal cell apoptotic process
RNA-seq EntryA_BomoOtmSK_comp451_c0_seq1
Sequence
(Amino Acid)
GRRMFPALQARLGGLLPNAQYLLLVDFVPLDDKRYRYAFHSSSWVVAGKADPISPPRFHL
HPDSPAPGSHWMRQLVSFDKLKLTNNQLDDNGHIILNSMHRYQPRLHVVYLPGEGQAATP
GTVPYRTFVFPETGFTAVTAYQNHRITQLKIASNPFAKGFRDCDPDDCPPEQSQQRVSTP
RRRESAPEPCSQLAQPYGGEPSTCGPLYAAHTHPMRYQPHS
(72 a.a.)

- SilkBase 1999-2023 -