SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK11799_complete:A_BomoOtmSK_comp14065_c0_seq2
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		decapentaplegic_isoform_X1_[Bombyx_mori]
Ontology
GO:0001708 P cell fate specification
GO:0001709 P cell fate determination
GO:0001715 P ectodermal cell fate specification
GO:0001745 P compound eye morphogenesis
GO:0005125 F cytokine activity
GO:0005160 F transforming growth factor beta receptor binding
GO:0005515 F protein binding
GO:0005518 F collagen binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005622 C intracellular anatomical structure
GO:0005768 C endosome
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007281 P germ cell development
GO:0007304 P chorion-containing eggshell formation
GO:0007313 P maternal specification of dorsal/ventral axis, oocyte, soma encoded
GO:0007352 P zygotic specification of dorsal/ventral axis
GO:0007354 P zygotic determination of anterior/posterior axis, embryo
GO:0007378 P amnioserosa formation
GO:0007391 P dorsal closure
GO:0007393 P dorsal closure, leading edge cell fate determination
GO:0007398 P ectoderm development
GO:0007423 P sensory organ development
GO:0007424 P open tracheal system development
GO:0007425 P epithelial cell fate determination, open tracheal system
GO:0007427 P epithelial cell migration, open tracheal system
GO:0007440 P foregut morphogenesis
GO:0007442 P hindgut morphogenesis
GO:0007443 P Malpighian tubule morphogenesis
GO:0007444 P imaginal disc development
GO:0007446 P imaginal disc growth
GO:0007447 P imaginal disc pattern formation
GO:0007448 P anterior/posterior pattern specification, imaginal disc
GO:0007450 P dorsal/ventral pattern formation, imaginal disc
GO:0007455 P eye-antennal disc morphogenesis
GO:0007458 P progression of morphogenetic furrow involved in compound eye morphogenesis
GO:0007473 P wing disc proximal/distal pattern formation
GO:0007474 P imaginal disc-derived wing vein specification
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007479 P leg disc proximal/distal pattern formation
GO:0007498 P mesoderm development
GO:0007507 P heart development
GO:0007516 P hemocyte development
GO:0008083 F growth factor activity
GO:0008201 F heparin binding
GO:0008285 P negative regulation of cell population proliferation
GO:0008354 P germ cell migration
GO:0008360 P regulation of cell shape
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0009948 P anterior/posterior axis specification
GO:0009950 P dorsal/ventral axis specification
GO:0010002 P cardioblast differentiation
GO:0010629 P negative regulation of gene expression
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0016015 F morphogen activity
GO:0017145 P stem cell division
GO:0019827 P stem cell population maintenance
GO:0030154 P cell differentiation
GO:0030509 P BMP signaling pathway
GO:0030707 P ovarian follicle cell development
GO:0030718 P germ-line stem cell population maintenance
GO:0030721 P spectrosome organization
GO:0035147 P branch fusion, open tracheal system
GO:0035156 P fusion cell fate specification
GO:0035158 P regulation of tube diameter, open tracheal system
GO:0035168 P larval lymph gland hemocyte differentiation
GO:0035214 P eye-antennal disc development
GO:0035215 P genital disc development
GO:0035217 P labial disc development
GO:0035222 P wing disc pattern formation
GO:0035224 P genital disc anterior/posterior pattern formation
GO:0035230 C cytoneme
GO:0035263 P genital disc sexually dimorphic development
GO:0035309 P wing and notum subfield formation
GO:0036099 P female germ-line stem cell population maintenance
GO:0040007 P growth
GO:0042078 P germ-line stem cell division
GO:0042127 P regulation of cell population proliferation
GO:0042803 F protein homodimerization activity
GO:0042981 P regulation of apoptotic process
GO:0043408 P regulation of MAPK cascade
GO:0045476 P nurse cell apoptotic process
GO:0045570 P regulation of imaginal disc growth
GO:0045595 P regulation of cell differentiation
GO:0045705 P negative regulation of salivary gland boundary specification
GO:0046620 P regulation of organ growth
GO:0046843 P dorsal appendage formation
GO:0046845 P branched duct epithelial cell fate determination, open tracheal system
GO:0046982 F protein heterodimerization activity
GO:0048066 P developmental pigmentation
GO:0048100 P wing disc anterior/posterior pattern formation
GO:0048477 P oogenesis
GO:0048542 P lymph gland development
GO:0048619 P embryonic hindgut morphogenesis
GO:0048636 P positive regulation of muscle organ development
GO:0060323 P head morphogenesis
GO:0060395 P SMAD protein signal transduction
GO:0061320 P pericardial nephrocyte differentiation
GO:0061327 P anterior Malpighian tubule development
GO:0061353 P BMP signaling pathway involved in Malpighian tubule cell chemotaxis
RNA-seq EntryA_BomoOtmSK_comp14065_c0_seq2
Sequence
(Amino Acid)
MRGACACAVVCALVALCAAAGLDEATRVAAEKQLLALLGLPKRPSRRSAPVPPIPRAMRM
LYEASGAIPAAAANTARSYQHVPTELDARFPGEHRFRLFFNLSGVPSDEVARGADLKFHR
ATEETGPQRLLLYDVVRPGRRGKTTPILRLLDSVTLLPGEGTVTADAIDAVRRWLLETDQ
NHGLLVRVIEEGQHNVDAKRPHVRVRRRATEDEEEWRSQQPLLLLYTEDARAREARENGE
SRLTRNKRATQRRGHRPHHRRKEAREICQRRPLFVDFAEVGWSDWIVAPPGYEAYFCQGD
CPFPLADHLNGTNHAIVQTLVNSVDPALVPKACCIPTQLSPISMLYMDEHNQVVLKNYQD
MMVMGCGCR
*(122 a.a.)

- SilkBase 1999-2023 -