SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK116_internal:A_BomoOtmSK_comp443_c0_seq1
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		homeobox_protein_MOX-2_[Bombyx_mori]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001205 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001525 P angiogenesis
GO:0001757 P somite specification
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007519 P skeletal muscle tissue development
GO:0008015 P blood circulation
GO:0016607 C nuclear speck
GO:0043565 F sequence-specific DNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0060021 P roof of mouth development
GO:0060173 P limb development
GO:0070997 P neuron death
RNA-seq EntryA_BomoOtmSK_comp443_c0_seq1
Sequence
(Amino Acid)
FYVESLYSHTLILRTQAFKVTESYSRSFLNLKNSARKGRCKMEYIRTDFQAYEDTDKYVY
ETNIQSYQPNYYESYANVDCPREMLPQNYMQMFYEYHPERDEDDWWSSWDDSVLVKEEIE
GDASAAGSSISDEGLQSPAGSRKERTAFTKAQIKSLEAEFARANYLTRLRRYEIAVALHL
TERQVKVWFQNRRMKWKRTKGAKHNKK
(68 a.a.)

- SilkBase 1999-2023 -