SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK1132_5prime_partial:A_BomoOtmSK_comp4638_c0_seq1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		breast_cancer_type_2_susceptibility_protein_homolog_[Bombyx_mori]
Ontology
GO:0000724 P double-strand break repair via homologous recombination
GO:0000910 P cytokinesis
GO:0003677 F DNA binding
GO:0003697 F single-stranded DNA binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006302 P double-strand break repair
GO:0006310 P DNA recombination
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0030141 C secretory granule
GO:0033593 C BRCA2-MAGE-D1 complex
GO:0033600 P negative regulation of mammary gland epithelial cell proliferation
GO:0042127 P regulation of cell population proliferation
GO:0043015 F gamma-tubulin binding
GO:0043234 C protein-containing complex
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0051276 P chromosome organization
GO:0051298 P centrosome duplication
RNA-seq EntryA_BomoOtmSK_comp4638_c0_seq1
Sequence
(Amino Acid)
LHLSIQQESQDVDSQEMSCRRDSDSGSQLYRQMKRSTDPGEFRSDLTASQNHILQQHLDS
RRDAVVARLQSEFRARAEGTLARRNVAVVLRVRVLDPGPDCATRGTLSVWNPTEEVLELL
QEGNSIEVTNVTPTAVR
*(45 a.a.)

- SilkBase 1999-2023 -