| Name | O_BomoOtmSK11252_complete:A_BomoOtmSK_comp13855_c0_seq2 |
| Scaffold_id | Bomo_Chr12 |
NCBI non-redundant (nr) | arginine/serine-rich_splicing_factor_7_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000398 |
P |
mRNA splicing, via spliceosome |
| GO:0003676 |
F |
nucleic acid binding |
| GO:0003723 |
F |
RNA binding |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005737 |
C |
cytoplasm |
| GO:0006369 |
P |
termination of RNA polymerase II transcription |
| GO:0006397 |
P |
mRNA processing |
| GO:0006405 |
P |
RNA export from nucleus |
| GO:0006406 |
P |
mRNA export from nucleus |
| GO:0006810 |
P |
transport |
| GO:0008270 |
F |
zinc ion binding |
| GO:0008380 |
P |
RNA splicing |
| GO:0031124 |
P |
mRNA 3'-end processing |
| GO:0044822 |
F |
RNA binding |
| GO:0046872 |
F |
metal ion binding |
| GO:0048025 |
P |
negative regulation of mRNA splicing, via spliceosome |
| GO:0051028 |
P |
mRNA transport |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_BomoOtmSK_comp13855_c0_seq2 |
Sequence (Amino Acid) | MSRYGDCKVYVGDLGNNASKPELEDAFSYYGPLRNVWVARNPPGFAFVEFEDPRDAEDAV
RGLDGRTICGRRARVEMSNGGRGYGSRGPPPRSRLPPRPYDDRCYDCGDRGHYARDCSRR
RRRSRSRSRRRSRSRSPRSGSRSRSRSRSRSRSRSKARSMSRSRSRSPSKDSKKSN
*(58 a.a.) |