SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK11017_internal:A_BomoOtmSK_comp13736_c0_seq1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		ras_GTPase-activating_protein_1_[Bombyx_mori]
Ontology
GO:0000165 P MAPK cascade
GO:0000281 P mitotic cytokinesis
GO:0001570 P vasculogenesis
GO:0001726 C ruffle
GO:0001948 F protein binding
GO:0001953 P negative regulation of cell-matrix adhesion
GO:0005096 F GTPase activator activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007162 P negative regulation of cell adhesion
GO:0007165 P signal transduction
GO:0008360 P regulation of cell shape
GO:0009790 P embryo development
GO:0019870 F potassium channel inhibitor activity
GO:0030833 P regulation of actin filament polymerization
GO:0031235 C intrinsic component of the cytoplasmic side of the plasma membrane
GO:0035556 P intracellular signal transduction
GO:0043087 P regulation of GTPase activity
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0046580 P negative regulation of Ras protein signal transduction
GO:0048013 P ephrin receptor signaling pathway
GO:0048514 P blood vessel morphogenesis
GO:0051020 F GTPase binding
GO:0051252 P regulation of RNA metabolic process
RNA-seq EntryA_BomoOtmSK_comp13736_c0_seq1
Sequence
(Amino Acid)
RPRPSPDPHWDDEFFFDDMPPDVTSFTITVHNTGKRGKESEVAELTIELANLANGEEIEE
WYPLVGMTPIGEWGSLRLRIRYMQELVMPREEYNPLRQLLLEPGIPAVKALADLCRTDRQ
PL
(39 a.a.)

- SilkBase 1999-2023 -