SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK10964_5prime_partial:A_BomoOtmSK_comp13705_c0_seq3
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
cyclic_AMP-dependent_transcription_factor_ATF-6_beta_isoform_X2_[Bombyx_mori]
Ontology
GO:0000976 F transcription cis-regulatory region binding
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001654 P eye development
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006986 P response to unfolded protein
GO:0007601 P visual perception
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0031625 F ubiquitin protein ligase binding
GO:0035497 F cAMP response element binding
GO:0042802 F identical protein binding
GO:0043565 F sequence-specific DNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:1990440 P positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
RNA-seq EntryA_BomoOtmSK_comp13705_c0_seq3
Sequence
(Amino Acid)
SVVAVATYHGCYAPDFAESAVIDYDLYTKPMRKSMNDINMEDFGEWNTLLQALDRRDDTF
YVVGVGKGEHLLLPAVSHNVTRPPKMALILPARNGNDSILNDHVMLMQIDCSVLNTTLVK
LRSDALPESLRKTQTNDKVRSDKFDIKKVNKETIDASLSKVLQNASNNLPNNIIKRNKIS
TNLDYDMMSNYLMSKEDPKPANKVQKVQYTESNNVTVSP
*(72 a.a.)

- SilkBase 1999-2023 -