SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK10932_internal:A_BomoOtmSK_comp13694_c0_seq8
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		serine-protein_kinase_ATM_[Bombyx_mori]
Ontology
GO:0000077 P DNA damage checkpoint signaling
GO:0000166 F nucleotide binding
GO:0000723 P telomere maintenance
GO:0002331 P pre-B cell allelic exclusion
GO:0003677 F DNA binding
GO:0003735 F structural constituent of ribosome
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005840 C ribosome
GO:0006281 P DNA repair
GO:0006412 P translation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007094 P mitotic spindle assembly checkpoint signaling
GO:0010212 P response to ionizing radiation
GO:0016023 C cytoplasmic vesicle
GO:0016301 F kinase activity
GO:0016303 F 1-phosphatidylinositol-3-kinase activity
GO:0016310 P phosphorylation
GO:0016572 P histone phosphorylation
GO:0016740 F transferase activity
GO:0016773 F phosphotransferase activity, alcohol group as acceptor
GO:0031410 C cytoplasmic vesicle
GO:0036092 P phosphatidylinositol-3-phosphate biosynthetic process
GO:0047485 F protein N-terminus binding
GO:0071044 P histone mRNA catabolic process
GO:0090399 P replicative senescence
RNA-seq EntryA_BomoOtmSK_comp13694_c0_seq8
Sequence
(Amino Acid)
SPGAHARYRPKDLSCMDARKKMEMNRESRQSNNEKLTVFLNILRDFKPVFHYFFTEHYHN
PVSWYERRLAYTKSVAASSMVGYILGLGDRHVQNILIDKHTAEVIHIDFGIAFDQGKALT
TPETVPFRLTQDLVSG
(44 a.a.)

- SilkBase 1999-2023 -