SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK10882_internal:A_BomoOtmSK_comp13682_c0_seq1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		Sal-like_protein_1_[Papilio_machaon]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000792 C heterochromatin
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001657 P ureteric bud development
GO:0001658 P branching involved in ureteric bud morphogenesis
GO:0001822 P kidney development
GO:0003281 P ventricular septum development
GO:0003337 P mesenchymal to epithelial transition involved in metanephros morphogenesis
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0004407 F histone deacetylase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007507 P heart development
GO:0008013 F beta-catenin binding
GO:0008406 P gonad development
GO:0010369 C chromocenter
GO:0016575 P histone deacetylation
GO:0016581 C NuRD complex
GO:0021553 P olfactory nerve development
GO:0021889 P olfactory bulb interneuron differentiation
GO:0021983 P pituitary gland development
GO:0022008 P neurogenesis
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0030325 P adrenal gland development
GO:0031129 P inductive cell-cell signaling
GO:0035019 P somatic stem cell population maintenance
GO:0042473 P outer ear morphogenesis
GO:0042733 P embryonic digit morphogenesis
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048566 P embryonic digestive tract development
GO:0060173 P limb development
GO:0061034 P olfactory bulb mitral cell layer development
GO:0072073 P kidney epithelium development
GO:0072092 P ureteric bud invasion
RNA-seq EntryA_BomoOtmSK_comp13682_c0_seq1
Sequence
(Amino Acid)
RTFPTYPLFPQSPPSSLSSGSLTPFTQCPVLNNVQNVVDVDLSRDPLFYNALLPRPGSND
NSWESLIEITKTSETSKLQQMVDNIDNKLSDPNECVVCHRVLSCKSALQMHYRTHTGERP
FRCKLCGRAFTTKGNLKTHMGVHRIKPQIQILHQCPVCHKKFSDPNTLHQHVRLHTSSRL
NAPYEHFRDIDSNSSQLFNIRSDVSDYSPYSSIPPVSFPTPSTPGDRRADSCGTDDESGR
DEREPAIREFDDDSDLKDRRTSPLSVCASASESELKTITTTASLPSATGSESGRSARTSP
PSPTMSTPSTPPRLPHHSPLPSPPTPLAALGALGGSPFSPLGLAFPPAVRGNTTCSICYK
TFACNSALEIHYRSHTKERPFKCTVCDRGFSTKSSGGGCRCGRRTRAPRPPH
(136 a.a.)

- SilkBase 1999-2023 -