SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK10833_complete:A_BomoOtmSK_comp13672_c0_seq2
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
caspase-5_isoform_b_[Bombyx_mori]
Ontology
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0004175 F endopeptidase activity
GO:0004197 F cysteine-type endopeptidase activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006508 P proteolysis
GO:0006915 P apoptotic process
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0007291 P sperm individualization
GO:0007417 P central nervous system development
GO:0007423 P sensory organ development
GO:0007516 P hemocyte development
GO:0007552 P metamorphosis
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0008258 P head involution
GO:0008285 P negative regulation of cell population proliferation
GO:0008340 P determination of adult lifespan
GO:0010506 P regulation of autophagy
GO:0010623 P programmed cell death involved in cell development
GO:0010941 P regulation of cell death
GO:0012501 P programmed cell death
GO:0016322 P neuron remodeling
GO:0016540 P protein autoprocessing
GO:0016787 F hydrolase activity
GO:0031638 P zymogen activation
GO:0035006 P melanization defense response
GO:0035070 P salivary gland histolysis
GO:0035071 P salivary gland cell autophagic cell death
GO:0035234 P ectopic germ cell programmed cell death
GO:0042803 F protein homodimerization activity
GO:0043293 C apoptosome
GO:0045476 P nurse cell apoptotic process
GO:0046668 P regulation of retinal cell programmed cell death
GO:0046672 P positive regulation of compound eye retinal cell programmed cell death
GO:0048102 P autophagic cell death
GO:0048749 P compound eye development
GO:0048813 P dendrite morphogenesis
GO:0050700 F CARD domain binding
GO:0051291 P protein heterooligomerization
GO:0097190 P apoptotic signaling pathway
GO:0097199 F cysteine-type endopeptidase activity involved in apoptotic signaling pathway
GO:2001269 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
RNA-seq EntryA_BomoOtmSK_comp13672_c0_seq2
Sequence
(Amino Acid)
MQEEHKKAIQRNFSSLVEGTDLDSMVMALYEKGVFSQQMIEPYRDTSITPRERKRILYRE
ITRRGPQAFTMLLEALREMGHWDLVRDLDPNSPLQLRARRPVLPPNLSGPQDNFVSLTIE
KHKPKNNNNDIIKRE
*(44 a.a.)

- SilkBase 1999-2023 -