SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK10808_5prime_partial:A_BomoOtmSK_comp13663_c0_seq1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)		ATP-binding_cassette_sub-family_A_member_3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0005215 F transporter activity
GO:0005319 F lipid transporter activity
GO:0005524 F ATP binding
GO:0005615 C extracellular space
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016887 F ATP hydrolysis activity
GO:0042493 P response to xenobiotic stimulus
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0044267 P cellular protein metabolic process
GO:0051384 P response to glucocorticoid
GO:0055085 P transmembrane transport
GO:0097208 C alveolar lamellar body
GO:0097232 C lamellar body membrane
GO:0097233 C alveolar lamellar body membrane
RNA-seq EntryA_BomoOtmSK_comp13663_c0_seq1
Sequence
(Amino Acid)
AGHALLLKIAHAPAADEVDGAKGELDRLKGVLHQSFDCTLKDEHKTMLHYHINETMKYSE
LFAQLEELKANFPGLVEDYSVTETTLEEVFLSFAKEQNEPASV
*(33 a.a.)

- SilkBase 1999-2023 -