SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK10616_complete:A_BomoOtmSK_comp13592_c0_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
CD63_antigen_[Bombyx_mori]
Ontology
GO:0002092 P positive regulation of receptor internalization
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005770 C late endosome
GO:0005771 C multivesicular body
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0007155 P cell adhesion
GO:0007160 P cell-matrix adhesion
GO:0009986 C cell surface
GO:0010008 C endosome membrane
GO:0010633 P negative regulation of epithelial cell migration
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016477 P cell migration
GO:0030855 P epithelial cell differentiation
GO:0031226 C intrinsic component of plasma membrane
GO:0031902 C late endosome membrane
GO:0031904 C endosome lumen
GO:0032403 F protein-containing complex binding
GO:0032585 C multivesicular body membrane
GO:0034613 P cellular protein localization
GO:0035646 P endosome to melanosome transport
GO:0042470 C melanosome
GO:0043234 C protein-containing complex
GO:0043473 P pigmentation
GO:0045785 P positive regulation of cell adhesion
GO:0045807 P positive regulation of endocytosis
GO:0048757 P pigment granule maturation
GO:0050931 P pigment cell differentiation
GO:0070062 C extracellular exosome
GO:0097487 C multivesicular body, internal vesicle
GO:1900746 P regulation of vascular endothelial growth factor signaling pathway
GO:2000680 P obsolete regulation of rubidium ion transport
GO:2001046 P positive regulation of integrin-mediated signaling pathway
RNA-seq EntryA_BomoOtmSK_comp13592_c0_seq1
Sequence
(Amino Acid)
MTQQKELGMKCIKYMLLCITAIFVLTSALTISVGTTIYAIYHDISFFLSPYAFSPAIFVI
AIGVIMLFVSLFGCIGALKESTCLVNIFAVILSIVFILEIAAAITAYSLRSEVSQFLDKK
LREALPLYYQHAEAQDAFDFIQYELNCCGVDSYMDWHAVDPPTGGTGISFANLTVPDSCC
AQSHMTVVGEETIVECHKIYANGCLPRVYYLVNQSAGLLGAGALTICFIQIIGIVFSFSL
ASSIRKAKIERERRRWEIQERMINAHTSLNPNNEKVAPVVYVPFQGQAGA
*(96 a.a.)

- SilkBase 1999-2023 -