SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK10615_internal:A_BomoOtmSK_comp13590_c0_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
nuclear_pore_complex_protein_Nup155_[Bombyx_mori]
Ontology
GO:0000972 P transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0005215 F transporter activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005643 C nuclear pore
GO:0006405 P RNA export from nucleus
GO:0006406 P mRNA export from nucleus
GO:0006409 P tRNA export from nucleus
GO:0006606 P protein import into nucleus
GO:0006810 P transport
GO:0006913 P nucleocytoplasmic transport
GO:0006998 P nuclear envelope organization
GO:0007077 P mitotic nuclear membrane disassembly
GO:0010827 P regulation of glucose transmembrane transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016925 P protein sumoylation
GO:0017056 F structural constituent of nuclear pore
GO:0019083 P viral transcription
GO:0031047 P gene silencing by RNA
GO:0031965 C nuclear membrane
GO:0036228 P protein localization to nuclear inner membrane
GO:0044611 C nuclear pore inner ring
GO:0051028 P mRNA transport
GO:0075733 P intracellular transport of virus
GO:0086014 P atrial cardiac muscle cell action potential
GO:1900034 P regulation of cellular response to heat
RNA-seq EntryA_BomoOtmSK_comp13590_c0_seq1
Sequence
(Amino Acid)
ADRYNLWECKLAIVQCSGHNDALLVENIWSNILAEAEAAASALPAPDERLASVLSKITTL
GREYVNTGHCFPLYFIARQLEIMSCKLRADQSMVFKAILSIGVSLEQVLDIYIKLVSVNE
RVWLGCGEETHACGAAARL
(45 a.a.)

- SilkBase 1999-2023 -