SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK10613_complete:A_BomoOtmSK_comp13586_c0_seq1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)		proteasome_subunit_alpha_type-4_[Papilio_xuthus]
Ontology
GO:0000165 P MAPK cascade
GO:0000209 P protein polyubiquitination
GO:0000502 C proteasome complex
GO:0000932 C P-body
GO:0002223 P stimulatory C-type lectin receptor signaling pathway
GO:0002479 P antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
GO:0004175 F endopeptidase activity
GO:0004298 F threonine-type endopeptidase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005839 C proteasome core complex
GO:0006508 P proteolysis
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006521 P regulation of cellular amino acid metabolic process
GO:0008233 F peptidase activity
GO:0016032 P viral process
GO:0016787 F hydrolase activity
GO:0019773 C proteasome core complex, alpha-subunit complex
GO:0031145 P anaphase-promoting complex-dependent catabolic process
GO:0033209 P tumor necrosis factor-mediated signaling pathway
GO:0038061 P NIK/NF-kappaB signaling
GO:0038095 P Fc-epsilon receptor signaling pathway
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043231 C intracellular membrane-bounded organelle
GO:0043488 P regulation of mRNA stability
GO:0050852 P T cell receptor signaling pathway
GO:0051436 P obsolete negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0051437 P obsolete positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
GO:0051603 P proteolysis involved in cellular protein catabolic process
GO:0060071 P Wnt signaling pathway, planar cell polarity pathway
GO:0070062 C extracellular exosome
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0090263 P positive regulation of canonical Wnt signaling pathway
RNA-seq EntryA_BomoOtmSK_comp13586_c0_seq1
Sequence
(Amino Acid)
MARRYDTRTTIFSPEGRLYQVEYAMEAISHAGTSLGILATDGILLAAERRNTNKLLDEVF
FSEKIYKLNDDMVCSVAGITSDANVLTNELRLIAQRYLLQYGESIPCEQLVSWLCDVKQA
YTQYGGKRPFGVSILYMGWDKHYGYQLYQSDPSGNYGGWKATCIGNNSAAAVSSLKQEYK
ENETTLAEAQALAIKVLSKTLDMTKLTPEKVEMATLTRKDNKTIIRILANTEVEKLIAEF
EKTEAEAEAAKKQPAKS
*(85 a.a.)

- SilkBase 1999-2023 -