SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoOtmSK10548_complete:A_BomoOtmSK_comp13567_c2_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		armadillo_segment_polarity_protein_isoform_X2_[Bombyx_mori]
Ontology
GO:0000902 P cell morphogenesis
GO:0001105 F transcription coactivator activity
GO:0001709 P cell fate determination
GO:0001745 P compound eye morphogenesis
GO:0003136 P negative regulation of heart induction by canonical Wnt signaling pathway
GO:0003713 F transcription coactivator activity
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005914 C spot adherens junction
GO:0005915 C zonula adherens
GO:0007016 P obsolete cytoskeletal anchoring at plasma membrane
GO:0007155 P cell adhesion
GO:0007163 P establishment or maintenance of cell polarity
GO:0007275 P multicellular organism development
GO:0007293 P germarium-derived egg chamber formation
GO:0007367 P segment polarity determination
GO:0007370 P ventral furrow formation
GO:0007391 P dorsal closure
GO:0007399 P nervous system development
GO:0007400 P neuroblast fate determination
GO:0007472 P wing disc morphogenesis
GO:0007507 P heart development
GO:0007616 P long-term memory
GO:0008092 F cytoskeletal protein binding
GO:0008134 F transcription factor binding
GO:0008360 P regulation of cell shape
GO:0014017 P neuroblast fate commitment
GO:0014019 P neuroblast development
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016324 C apical plasma membrane
GO:0016327 C apicolateral plasma membrane
GO:0016337 P cell-cell adhesion
GO:0016342 C catenin complex
GO:0019900 F kinase binding
GO:0019903 F protein phosphatase binding
GO:0030054 C cell junction
GO:0030139 C endocytic vesicle
GO:0030424 C axon
GO:0030707 P ovarian follicle cell development
GO:0030720 P oocyte localization involved in germarium-derived egg chamber formation
GO:0032403 F protein-containing complex binding
GO:0034333 P adherens junction assembly
GO:0035017 P cuticle pattern formation
GO:0035019 P somatic stem cell population maintenance
GO:0035147 P branch fusion, open tracheal system
GO:0035153 P epithelial cell type specification, open tracheal system
GO:0035293 P chitin-based larval cuticle pattern formation
GO:0045186 P zonula adherens assembly
GO:0045294 F alpha-catenin binding
GO:0045296 F cadherin binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046530 P photoreceptor cell differentiation
GO:0046667 P compound eye retinal cell programmed cell death
GO:0048477 P oogenesis
GO:0048526 P imaginal disc-derived wing expansion
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0060232 P delamination
GO:0060429 P epithelium development
GO:0060914 P heart formation
GO:0071896 P protein localization to adherens junction
GO:0072659 P protein localization to plasma membrane
RNA-seq EntryA_BomoOtmSK_comp13567_c2_seq1
Sequence
(Amino Acid)
MSYQIPSSQSRTMSHSSYVASDVPMAPNKEQQTLMWQQNSYLVDSGINSGAATQVPSLTG
KEDDEMEGDQLMFDLDQGFAQGFTQEQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPS
TQLDPAQPTAVQRLAEPSQMLKHAVVNLINYQDDADLATRAIPELIKLLNDEDQVVVSQA
AMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLETTKGAVGTLHNLSHHRQGLLAI
FKSGGIPALVKLLSSPVEAVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRNNV
KFLAIVTDCLQILAYGNQESKLIILASQGPIELVRIMRSYDYEKLLWTTSRVLKVLSVCS
SNKPAIVEAGGMQALAMHLGNPSGRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLAS
TDVNIVTCAAGILSNLTCNNQRNKMTVCQVGGVDALVRTVVSAGDREEITEPAICALRHL
TSRHDDSEMAQNAVRLHYGLPVIVKLLQPPSRWPLVKAVVGLVRNLALCSANYAPLREHG
AVHHLVRLLMRAYNDTQRQRSSSGSGANTAYADGVRMEEIVEGAVGALHILAKESHNRQL
IRQQNVIPIFVQLLFNEIENIQRVAAGVLCELAVEKEGAEMIEAEGATAPLTELLHSRNE
GVATYAAAVLFRMSEDKPHDYKKRLSMELTNSLFRDDHQMWSNDLPIQSDIQDMLGPEQG
YEGLYGTRPSFHQQA
*(244 a.a.)

- SilkBase 1999-2023 -