Name | O_BomoOtmSK10452_complete:A_BomoOtmSK_comp13527_c0_seq4 |
Scaffold_id | Bomo_Chr3 |
NCBI non-redundant (nr) | RNA-binding_protein_lark_[Bombyx_mori] |
Ontology |
GO:0000166 |
F |
nucleotide binding |
GO:0000398 |
P |
mRNA splicing, via spliceosome |
GO:0003676 |
F |
nucleic acid binding |
GO:0003723 |
F |
RNA binding |
GO:0003729 |
F |
mRNA binding |
GO:0005634 |
C |
nucleus |
GO:0005737 |
C |
cytoplasm |
GO:0005829 |
C |
cytosol |
GO:0007067 |
P |
mitotic cell cycle |
GO:0007303 |
P |
cytoplasmic transport, nurse cell to oocyte |
GO:0007562 |
P |
eclosion |
GO:0007623 |
P |
circadian rhythm |
GO:0008062 |
P |
eclosion rhythm |
GO:0008104 |
P |
protein localization |
GO:0008270 |
F |
zinc ion binding |
GO:0009790 |
P |
embryo development |
GO:0030036 |
P |
actin cytoskeleton organization |
GO:0040011 |
P |
locomotion |
GO:0045475 |
P |
locomotor rhythm |
GO:0045804 |
P |
negative regulation of eclosion |
GO:0045995 |
P |
regulation of embryonic development |
GO:0046872 |
F |
metal ion binding |
GO:0048511 |
P |
rhythmic process |
GO:0071011 |
C |
precatalytic spliceosome |
GO:0071013 |
C |
catalytic step 2 spliceosome |
|
RNA-seq Entry | A_BomoOtmSK_comp13527_c0_seq4 |
Sequence (Amino Acid) | MFAPRQDPYDGYYDRSRFDSPRDLFERRYPVGGASRGLELGGSRGARGDFVSPPLRREPM
PPMPNLPPLRSGMGSMRSSYDPMYSRRSPPPGPQMSRGMYEDFSRDTFDDRRPGMRGPSP
SRRYAPY
*(41 a.a.) |