SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoOtmSK10440_5prime_partial:A_BomoOtmSK_comp13524_c0_seq3
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
lamin-C_[Bombyx_mori]
Ontology
GO:0001745 P compound eye morphogenesis
GO:0005102 F signaling receptor binding
GO:0005198 F structural molecule activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005638 C lamin filament
GO:0005652 C nuclear lamina
GO:0005811 C lipid droplet
GO:0005813 C centrosome
GO:0005875 C microtubule associated complex
GO:0005882 C intermediate filament
GO:0006342 P heterochromatin assembly
GO:0006997 P nucleus organization
GO:0006998 P nuclear envelope organization
GO:0007084 P mitotic nuclear membrane reassembly
GO:0007097 P nuclear migration
GO:0007283 P spermatogenesis
GO:0007417 P central nervous system development
GO:0007430 P terminal branching, open tracheal system
GO:0007569 P cell aging
GO:0008285 P negative regulation of cell population proliferation
GO:0008344 P adult locomotory behavior
GO:0016020 C membrane
GO:0031081 P nuclear pore localization
GO:0035262 P gonad morphogenesis
GO:0040003 P chitin-based cuticle development
GO:0046331 P lateral inhibition
GO:0048546 P digestive tract morphogenesis
GO:0050777 P negative regulation of immune response
GO:0051297 P centrosome cycle
GO:0070870 P obsolete heterochromatin maintenance
GO:0071763 P nuclear membrane organization
GO:0072686 C mitotic spindle
GO:0090435 P protein localization to nuclear envelope
RNA-seq EntryA_BomoOtmSK_comp13524_c0_seq3
Sequence
(Amino Acid)
TPSRRATPLRAARKRTLLDETEERSLQDFSVTSSAKGDLEVAEACPDGTFVKIRNKGKKE
LSLGGYQILRKAGDQETVFKFHRTVKLEPGAVSTVWSADTGASHDPPHDIVMKGQKWFVA
DTFTTALLNNEQEEVAISERQRRQISTSAQRHRELAHKYPRREQIGEIREGEENCRIM
*(58 a.a.)

- SilkBase 1999-2023 -