SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE862_internal:A_BomoN4EE_TR10515_c0_g1_i1
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)
PREDICTED:_photoreceptor-specific_nuclear_receptor_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0001752 P compound eye photoreceptor fate commitment
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003707 F steroid hormone receptor activity
GO:0004872 F signaling receptor activity
GO:0004879 F nuclear receptor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007270 P neuron-neuron synaptic transmission
GO:0007417 P central nervous system development
GO:0007419 P ventral cord development
GO:0007462 P R1/R6 cell fate commitment
GO:0007464 P R3/R4 cell fate commitment
GO:0007465 P R7 cell fate commitment
GO:0007503 P fat body development
GO:0007507 P heart development
GO:0007510 P cardioblast cell fate determination
GO:0007601 P visual perception
GO:0008270 F zinc ion binding
GO:0010906 P regulation of glucose metabolic process
GO:0014019 P neuroblast development
GO:0021782 P glial cell development
GO:0030522 P intracellular receptor signaling pathway
GO:0042331 P phototaxis
GO:0042803 F protein homodimerization activity
GO:0043401 P steroid hormone mediated signaling pathway
GO:0043565 F sequence-specific DNA binding
GO:0046530 P photoreceptor cell differentiation
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048749 P compound eye development
GO:0050896 P response to stimulus
GO:0061331 P epithelial cell proliferation involved in Malpighian tubule morphogenesis
RNA-seq EntryA_BomoN4EE_TR10515_c0_g1_i1
Sequence
(Amino Acid)
VGVFGPPVSLAMALSPARYPLLSPPYAPPQPPAQPDSSRDHDDRAHTDSDDDSIDVTNEE
DSTSYSPPALTYGQNCAPYRPLGVESAAETAARLLFMAVKWAKNLPSFA
(35 a.a.)

- SilkBase 1999-2023 -