SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE859_5prime_partial:A_BomoN4EE_TR10446_c0_g1_i1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		PREDICTED:_nuclear_receptor_subfamily_2_group_E_member_1_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003707 F steroid hormone receptor activity
GO:0004879 F nuclear receptor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0007165 P signal transduction
GO:0007601 P visual perception
GO:0007602 P phototransduction
GO:0008270 F zinc ion binding
GO:0008285 P negative regulation of cell population proliferation
GO:0030522 P intracellular receptor signaling pathway
GO:0042462 P eye photoreceptor cell development
GO:0043401 P steroid hormone mediated signaling pathway
GO:0043565 F sequence-specific DNA binding
GO:0045872 P obsolete positive regulation of rhodopsin gene expression
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0050896 P response to stimulus
GO:0060041 P retina development in camera-type eye
RNA-seq EntryA_BomoN4EE_TR10446_c0_g1_i1
Sequence
(Amino Acid)
APLSAASSAGSSAAGTGACSPLPLVPDSFLPPPPPGLLHILMSTDKCHELMWSAKQLQLQ
GDPTLLRPPPSAFGAPLAPTWELLQETSARLLFMAVRWVRCLAPFQALSPSDQLVLLRAA
WKDLFLLHLAQWSAPWDLAPLLSAPAARARLPPDPLADLELNTLQEILCRFRQIAPDGSE
CGCMKAIVLFSPDTAGLSETQPVEMLQDQAQCILADYVRTRYTRQPTR
*(75 a.a.)

- SilkBase 1999-2023 -