| Name | O_BomoN4EE850_internal:A_BomoN4EE_TR10007_c0_g1_i1 |
| Scaffold_id | Bomo_Chr1 |
NCBI non-redundant
(nr) | ATP-binding_cassette_sub-family_B_member_3_[Trichoplusia_ni] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0001666 |
P |
response to hypoxia |
| GO:0005524 |
F |
ATP binding |
| GO:0005887 |
C |
integral component of plasma membrane |
| GO:0006810 |
P |
transport |
| GO:0006855 |
P |
xenobiotic transmembrane transport |
| GO:0008152 |
P |
metabolic process |
| GO:0008354 |
P |
germ cell migration |
| GO:0008559 |
F |
ABC-type xenobiotic transporter activity |
| GO:0015238 |
F |
xenobiotic transmembrane transporter activity |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016787 |
F |
hydrolase activity |
| GO:0016887 |
F |
ATP hydrolysis activity |
| GO:0031427 |
P |
response to methotrexate |
| GO:0042626 |
F |
ATPase-coupled transmembrane transporter activity |
| GO:0042908 |
P |
xenobiotic transport |
| GO:0055085 |
P |
transmembrane transport |
|
| RNA-seq Entry | A_BomoN4EE_TR10007_c0_g1_i1 |
Sequence
(Amino Acid) | DWQLLKLNAPEWPLITVGSIAAFLQGACFPVFALLFGFSSGIFILDNRDDIIYLADLYSV
LFVVIAAVAGISMCLQSTTFTSAGLKMTTRLRHQYFASLLKQEIGFFDKETNTVGAICAR
LSGDTAEVQGATGLRIGLIL
(45 a.a.) |
