SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE51033_complete:A_BomoN4EE_TR100517_c0_g1_i1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)
Von_Hippel-Lindau_disease_tumor_suppressor_[Papilio_machaon]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000902 P cell morphogenesis
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0005829 C cytosol
GO:0006355 P regulation of transcription, DNA-templated
GO:0006508 P proteolysis
GO:0008134 F transcription factor binding
GO:0008285 P negative regulation of cell population proliferation
GO:0016020 C membrane
GO:0016567 P protein ubiquitination
GO:0019899 F enzyme binding
GO:0030891 C VCB complex
GO:0043066 P negative regulation of apoptotic process
GO:0045597 P positive regulation of cell differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0050821 P protein stabilization
GO:0061418 P regulation of transcription from RNA polymerase II promoter in response to hypoxia
GO:0061428 P negative regulation of transcription from RNA polymerase II promoter in response to hypoxia
GO:0061630 F ubiquitin protein ligase activity
RNA-seq EntryA_BomoN4EE_TR100517_c0_g1_i1
Sequence
(Amino Acid)
MYGVGTTDSNLIYEVNDKGERVVVKSLVSSRRAFIRFTNRSSRPVAVWWRDFQGRKQHYI
NLDPTDFFDINTFVTHPWEFSDAATTDVFVINNKEIFRPPPIVGQVLFRTNWNITVPVRQ
LRRVAMLCVAVRLRNVEAVDALGLPRVLAQELREMVAKIRRELTSARIP
*(55 a.a.)

- SilkBase 1999-2023 -